PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G158900.1.p
Common NameLOC101770204, SETIT_014218mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 283aa    MW: 30238 Da    PI: 5.7683
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G158900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.4e-281569155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        +prlrWt++LH rF  av+qLGG++kAtPk++l++m v+ Ltl+h+kSHLQkYRl
  Seita.6G158900.1.p 15 RPRLRWTSQLHGRFELAVAQLGGADKATPKSVLRAMAVPELTLYHLKSHLQKYRL 69
                        59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-291373IPR009057Homeodomain-like
SuperFamilySSF466891.33E-141572IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-211670IPR006447Myb domain, plants
PfamPF143791.0E-15131170IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSSSGGGQQQ QGEGRPRLRW TSQLHGRFEL AVAQLGGADK ATPKSVLRAM AVPELTLYHL  60
KSHLQKYRLA VSRGLITTSP GDNGEGANDR SSSSENEYDE DAVAELHGAF TADDGAGAKE  120
GLCDSSRSMA RMHREVQRKL QEQIEVQRHL QLRIEAQGRY LQSVLHRAYE VLSDDHNLGS  180
PAATELSELA SAVESGCLSS SSSLSPSPPR RRAAGSCVTS SSSWEAESHA AAGSKRPCTC  240
AVEQPAQGKR TFLQQSHDHG AEEADADAEA EDGSSSEIDL NR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0646045e-63BT064604.1 Zea mays full-length cDNA clone ZM_BFc0189E19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973515.10.0PREDICTED: myb family transcription factor APL-like
TrEMBLK3YIZ90.0K3YIZ9_SETIT; Uncharacterized protein
STRINGSi014218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112643038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.19e-45G2-like family protein